PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G179800.1.p
Common NameSb08g022276, SORBIDRAFT_08g022276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GATA
Protein Properties Length: 303aa    MW: 33839.4 Da    PI: 8.7457
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G179800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA39.57.5e-13149179131
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                           CsnC + +Tp WR gp+g+ +LCnaCGl+ +
  Sobic.008G179800.1.p 149 CSNCLSCQTPRWRDGPSGPQMLCNACGLRLK 179
                           ****************************987 PP

2GATA55.95.7e-18233267135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++C ++kTp+WR gp g+ktLCnaCG++y++ +l
  Sobic.008G179800.1.p 233 CTHCLSSKTPQWRAGPLGPKTLCNACGVRYKSGRL 267
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.4E-8143215IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.848143179IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-10147183No hitNo description
CDDcd002023.00E-10148179No hitNo description
Gene3DG3DSA:3.30.50.107.1E-13148182IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.3E-10149179IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-14227277IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.53227263IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-14229291No hitNo description
Gene3DG3DSA:3.30.50.101.1E-13231265IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.94E-13232289No hitNo description
PfamPF003208.3E-16233267IPR000679Zinc finger, GATA-type
PROSITE patternPS003440233258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDVHPANAAA DSLGDLFPHQ PAGLESDESN IQWLSGYVED CFSSSTSYTN PVFARSASQG  60
AEKPKLPPPS SSNGRRKKRS LASVMTNDDD QQYIIPLYVE PPLILIDQKH WMAESELILP  120
KKDKDQEVCQ QQGQEEKCEK GVRRLVKRCS NCLSCQTPRW RDGPSGPQML CNACGLRLKP  180
ENRFATISEE HCGQETKKEQ EPGAQRDKKK KTMKKTYVND ALTLSSDQAE KRCTHCLSSK  240
TPQWRAGPLG PKTLCNACGV RYKSGRLLPE YRPANSPTFM SCIHSNSHKK VMQMRQAVAQ  300
QQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442575.10.0hypothetical protein SORBIDRAFT_08g022276, partial
TrEMBLC5YSI00.0C5YSI0_SORBI; Putative uncharacterized protein Sb08g022276 (Fragment)
STRINGSb08g022276.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-32GATA transcription factor 4